ABCD#1234 Johannes Jäger Johannes Jaeger Pharmakologische Wirkstoffe für das Nervensystem 102 7 AA PAT source 1..7 organism Homo sapiens mol_type protein REGION 1..7 note circular peptide SITE 1 note D-Alanine SITE 2 note D-Glutamic acid SITE 4 note Nle SITE 6 note D-Methionine SITE 7 note D-Norleucine AEKXGMX 6 AA PAT source 1..6 organism Homo sapiens mol_type protein SITE 1 note the N-terminus is acetylated SITE 4 note 6-amino-7-(1H-indol-3-yl)-5-oxoheptanoic acid SITE 6 note the C-terminus is methylated VAFXGK 4 AA PAT source 1..4 organism Homo sapiens mol_type protein SITE 1 note the N-terminus is acetylated SITE 4 note C-terminus linked via a glutaraldehyde bridge to dipeptide GK VAFW 5 AA PAT source 1..5 organism Homo sapiens mol_type protein REGION >5 note The entire sequence of amino acids 1-5 can be repeated one or more times VARIANT 5 note X can be any amino acid GGGGX 12 DNA PAT source 1..12 organism synthetic construct mol_type other DNA misc_feature 12 note cytosine attached to a C3 spacer, which is joined to another nucleic acid atgcatgcatgc 12 DNA PAT source 1..12 organism synthetic construct mol_type other DNA misc_feature 1 note cytosine attached to a C3 spacer, which is joined to another nucleic acid cggcatgcatgc 25 DNA PAT source 1..25 organism Mus musculus mol_type genomic DNA atgcatgcatgcvcggcatgcatgc 12 DNA PAT source 1..12 organism synthetic construct mol_type other DNA misc_feature 12 note cytosine is linked to a C3 spacer, which is linked to 5'-end of another nucleic acid atgcatgcatgc 12 DNA PAT source 1..12 organism synthetic construct mol_type other DNA misc_feature 1 note cytosine is linked to a C3 spacer, which is linked to 3'-end of another nucleic acid cggcatgcatgc 18 DNA PAT source 1..18 organism Homo sapiens mol_type genomic DNA modified_base 11 mod_base OTHER note abasic site gagcattgacntaaggct 30 DNA PAT source 1..30 organism synthetic construct mol_type other DNA note GNA sequence modified_base 1..30 mod_base OTHER note 2,3-dihydroxypropyl nucleosides (glycol nucleic acids) tagttcattgactaaggctccccattgact 10 DNA PAT source 1..10 organism synthetic construct mol_type other DNA aatgccggag 10 DNA PAT source 1..10 organism synthetic construct mol_type other DNA aatgccggak 10 DNA PAT source 1..10 organism synthetic construct mol_type other DNA aatgccggac 10 DNA PAT source 1..10 organism Homo sapiens mol_type genomic DNA aatgttggac 15 DNA PAT source 1..15 organism synthetic construct mol_type other DNA nngkngkngkagvcr 7 AA PAT source 1..7 organism Homo sapiens mol_type protein VARIANT 1 note X can be any amino acid XYEKGJL 30 DNA PAT source 1..30 organism synthetic construct mol_type other DNA misc_feature 1 note This sequence is one of four branches of a branched polynucleotide cacacaaaaaaaaaaaaaaaaaaaaaaaaa 28 DNA PAT source 1..28 organism synthetic construct mol_type other DNA misc_feature 1 note This sequence is one of four branches of a branched polynucleotide. cacataggcatctcctagtgcaggaaga 75 RNA PAT source 1..75 organism Homo sapiens mol_type tRNA modified_base 39 mod_base p modified_base 54 mod_base p gcggatttagctcagctgggagagcgccagactgaatanctggagtcctgtgtncgatccacagaattcgcacca 44 DNA PAT source 1..44 organism Homo sapiens mol_type genomic DNA gatcattttttatattttttatattttttatattttttatgtac 44 DNA PAT source 1..44 organism Homo sapiens mol_type genomic DNA repeat_region 5..40 rpt_type tandem rpt_unit_seq atacgcact attcatacgcactatacgcactatacgcactatacgcactgtac 44 DNA PAT source 1..44 organism Homo sapiens mol_type genomic DNA repeat_region 5..40 rpt_type tandem rpt_unit_seq atacgcact gatcatacgcactatacgcactatacgcactatacgcactgtac 12 DNA PAT source 1..12 organism synthetic construct mol_type other DNA misc_difference 5..8 note A nucleotide in any of positions 5-8 may be replaced with inosine or pseudouridine. modified_base 5..8 mod_base OTHER note i or p gatcaaaagtac 74 AA PAT source 1..74 organism synthetic construct mol_type protein VARIANT 1..8 note X can be any amino acid VARIANT 10..19 note X can be any amino acid VARIANT 21..48 note X can be any amino acid VARIANT 50..68 note X can be any amino acid VARIANT 70..74 note X can be any amino acid XXXXXXXXDXXXXXXXXXXFXXXXXXXXXXXXXXXXXXXXXXXXXXXXAXXXXXXXXXXXXXXXXXXXGXXXXX 4 AA PAT source 1..4 organism synthetic construct mol_type protein SITE 1..4 note This sequence is one part of a branched amino acid sequence SITE 4 note Leu is linked to another sequence RISL 4 AA PAT source 1..4 organism synthetic construct mol_type protein SITE 1..4 note This sequence is one part of a branched amino acid sequence SITE 3 note The side chain of Lysine is linked via an amide linkage to another sequence SITE 4 note The side chain of Lysine is linked via an amide linkage to another sequence LLKK 6 AA PAT source 1..6 organism synthetic construct mol_type protein SITE 1..6 note This sequence is one part of a branched amino acid sequence SITE 6 note Ala is linked to another sequence IPACTA 6 AA PAT source 1..6 organism synthetic construct mol_type protein SITE 1..6 note This sequence is one part of a branched amino acid sequence SITE 6 note The side chain of Lysine is linked via an amide linkage to another sequence FRAGGK 5 AA PAT source 1..5 organism synthetic construct mol_type protein SITE 1..5 note This sequence is one part of a branched amino acid sequence SITE 5 note Ala is linked to another sequence HQYFA 8 AA PAT source 1..8 organism synthetic construct mol_type protein SITE 1..8 note This sequence is one part of a branched amino acid sequence SITE 5 note The side chain of Lysine is linked via an amide linkage to another sequence SITE 6 note The side chain of Lysine is linked via an amide linkage to another sequence SITE 7 note The side chain of Lysine is linked via an amide linkage to another sequence ATFGKKKA 8 AA PAT source 1..8 organism Homo sapiens mol_type protein SITE 5 note The side chain of Lysine is linked via an amide linkage to another sequence DGSAKKKK 5 AA PAT source 1..5 organism Homo sapiens mol_type protein SITE 5 note Gly is linked to another sequence AASHG 13 DNA PAT source 1..13 organism Homo sapiens mol_type genomic DNA atcgcaattggcc 13 DNA PAT source 1..13 organism Homo sapiens mol_type genomic DNA ggccaattgcgat 58 DNA PAT source 1..58 organism Homo sapiens mol_type genomic DNA tagttcattgactaaggctccccattgactaaggcgactagcattgactaaggcaagc 16 DNA PAT source 1..16 organism synthetic construct mol_type other DNA modified_base 1..16 mod_base OTHER note N-(2-aminoethyl) glycine nucleosides (PNA) modified_base 6 mod_base OTHER note N-(2-aminoethyl) glycine 5-nitroindole or N-(2-aminoethyl) glycine 3-nitroindole cgcctnagtcaatggg 25 DNA PAT source 1..25 organism Homo sapiens mol_type genomic DNA atcgggatcgcatattcgattggcc 25 DNA PAT source 1..25 organism Homo sapiens mol_type genomic DNA ggccaatatggcttgcgatcccgat 20 RNA PAT source 1..20 organism synthetic construct mol_type other RNA misc_feature 1 note The 5' phosphate of the thymidine is attached through the linker 3-hydroxybenzamido-N-propyl-3-phosphate to ccugucgt modified_base 1 mod_base OTHER note thymine tcctgtccggagatgttgat 8 AA PAT source 1..8 organism Homo sapiens mol_type protein VARIANT 4 note X can be any amino acid VARIANT 8 note X can be any amino acid GGGXGGGX 400 AA PAT source 1..400 organism synthetic construct mol_type protein VARIANT 4..400 note X can be any amino acid VARIANT 9..400 note Up to 98 copies of GGGX can be deleted GGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGXGGGX 000 8 AA PAT source 1..8 organism Homo sapiens mol_type protein VARIANT 4 note X can be any amino acid VARIANT 8 note X can be any amino acid GGGXGGGX 12 AA PAT source 1..12 organism Homo sapiens mol_type protein VARIANT 4 note X can be any amino acid VARIANT 8 note X can be any amino acid VARIANT 12 note X can be any amino acid GGGXGGGXGGGX 333 DNA PAT source 1..333 organism Homo sapiens mol_type genomic DNA CDS 19..114 translation MAPNTQTASPRALADSLMQLARQVSRLESGQ protein_id 47 CDS 115..222 translation MTMITDSLAVVLQRRDWENPGVTQLNRLAAHWCQK protein_id 48 CDS 251..283 translation MLRRQVNEVA protein_id 49 caattcagggtggtgaatatggcgcccaatacgcaaaccgcctctccccgcgcgttggccgattcattaatgcagctggccaggcaggtgagcaggctggaaagcgggcagtgaatgaccatgattacggattcactggccgtcgttttacaacgtcgtgactgggaaaaccctggcgttacccaacttaatcgccttgcagcacattggtgtcaaaaataataataaccggatgtactatttatccctgatgctgcgtcgtcaggtgaatgaagtcgcttaagcaatcaatgtcggatgcggcgcgacgcttatccgaccaacatatcataa 31 AA PAT source 1..31 organism Homo sapiens mol_type protein MAPNTQTASPRALADSLMQLARQVSRLESGQ 35 AA PAT source 1..35 organism Homo sapiens mol_type protein MTMITDSLAVVLQRRDWENPGVTQLNRLAAHWCQK 10 AA PAT source 1..10 organism Homo sapiens mol_type protein MLRRQVNEVA 10 AA PAT source 1..10 organism synthetic construct mol_type protein SITE 2 note Homoserine VARIANT 3..6 note A or G AXXXXXYLGS 10 AA PAT source 1..10 organism synthetic construct mol_type protein MOD_RES 2 note Hyl SITE 7 note Nle SITE 10 note delta-aminolevulinic acid AKYLGSXVSX 17 AA PAT source 1..17 organism Homo sapiens mol_type protein DISULFID 4..15 note intrachain disulfide bond CARBOHYD 9 note Asn side-chain N-linked to asialyloligosaccharide LEYCLKRWNETISHCAW 106 AA PAT source 1..106 organism synthetic construct mol_type protein LLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKYMR 53 AA PAT source 1..53 organism synthetic construct mol_type protein VARIANT 2..3 note X can be any amino acid VARIANT 5..24 note X can be any amino acid VARIANT 26..28 note X can be any amino acid VARIANT 30 note deleted VARIANT 30..49 note X can be any amino acid VARIANT 51..52 note X can be any amino acid KXXKXXXXXXXXXXXXXXXXXXXXKXXXKXXXXXXXXXXXXXXXXXXXXKXXK 52 AA PAT source 1..52 organism synthetic construct mol_type protein VARIANT 2..3 note X can be any amino acid VARIANT 5..24 note X can be any amino acid VARIANT 26..28 note X can be any amino acid VARIANT 29..30 note X is inserted VARIANT 30..48 note X can be any amino acid VARIANT 50..51 note X can be any amino acid KXXKXXXXXXXXXXXXXXXXXXXXKXXXKXXXXXXXXXXXXXXXXXXXKXXK 63 AA PAT source 1..63 organism synthetic construct mol_type protein VARIANT 2..3 note X can be any amino acid VARIANT 5..29 note X can be any amino acid; up to 10 residues may be deleted VARIANT 31..33 note X can be any amino acid VARIANT 35..59 note X can be any amino acid; up to 10 residues may be deleted VARIANT 61..62 note X can be any amino acid KXXKXXXXXXXXXXXXXXXXXXXXXXXXXKXXXKXXXXXXXXXXXXXXXXXXXXXXXXXKXXK 43 AA PAT source 1..43 organism synthetic construct mol_type protein VARIANT 2..3 note X can be any amino acid VARIANT 5..19 note X can be any amino acid; up to 10 X residues may be inserted VARIANT 21..23 note X can be any amino acid VARIANT 25..39 note X can be any amino acid; up to 10 X residues may be inserted VARIANT 41..42 note X can be any amino acid KXXKXXXXXXXXXXXXXXXKXXXKXXXXXXXXXXXXXXXKXXK 6 AA PAT source 1..6 organism synthetic construct mol_type protein SITE 1 note This residue is linked N-terminally to a peptide having an N-terminal Gly-Gly and a gap of undefined length VARIANT 5..6 note X can be any amino acid GGAGXX 45 DNA PAT source 1..45 organism Homo sapiens mol_type genomic DNA CDS 1..45 translation MTGNKPETDVYEIL protein_id 60 atgaccggaaataaacctgaaaccgatgtttacgaaattttatga 14 AA PAT source 1..14 organism Homo sapiens mol_type protein MTGNKPETDVYEIL 22 DNA PAT source 1..22 organism Drosophila melanogaster mol_type genomic DNA acattgaatctcataccacttt 19 DNA PAT source 1..19 organism Drosophila virilis mol_type genomic DNA acatggatcccacgacttt 22 DNA PAT source 1..22 organism Drosophila simulans mol_type genomic DNA gtatggcgtcgtatsgtagttt 7 AA PAT source 1..7 organism Homo sapiens mol_type protein VARIANT 7 note X is S or T GGGJATX 7 AA PAT source 1..7 organism Homo sapiens mol_type protein VARIANT 4 note replace with I VARIANT 7 note replace with T GGGLATS 7 AA PAT source 1..7 organism Homo sapiens mol_type protein VARIANT 4 note X can be any amino acid GLPXRIC 7 AA PAT source 1..7 organism Homo sapiens mol_type protein GLPVRIC 7 AA PAT source 1..7 organism Homo sapiens mol_type protein GLPTRIC 7 AA PAT source 1..7 organism Homo sapiens mol_type protein GLPDRIC 36 DNA PAT source 1..36 organism Homo sapiens mol_type genomic DNA cgaatgncccactacgaatgncacgaatgncccaca 36 DNA PAT source 1..36 organism Homo sapiens mol_type genomic DNA cgaatgacccactacgaatgbcacgaatgbcccaca 36 DNA PAT source 1..36 organism Homo sapiens mol_type genomic DNA cgaatgtcccactacgaatgvcacgaatgvcccaca 36 DNA PAT source 1..36 organism Homo sapiens mol_type genomic DNA cgaatggcccactacgaatghcacgaatghcccaca 36 DNA PAT source 1..36 organism Homo sapiens mol_type genomic DNA cgaatgccccactacgaatgdcacgaatgdcccaca 400 DNA PAT source 1..400 organism Homo sapiens mol_type genomic DNA CDS join(1..79,142..212,272..400) protein_id 76 translation MKTFAALLSAVTLALSVRAQAAVWSQCGGTPGWTGETTCVAGSVCTSLSSSYSQCVPGSATSSAPAAPSATTSGPAPTDGTCSASGAWPPLT atgaagactttcgcagccttgctttccgctgtcactctcgcgctctcggtgcgcgcccaggcggctgtctggagtcaatgtaagtgccgctgcttttcattgatacgagactctacgccgagctgacgtgctaccgtataggtggcggtacaccgggttggacgggcgagaccacttgcgttgctggttcggtttgtacctccttgagctcagtgagcgactttcaatccgtcgtcattgctcctcatgtattgacgattggccttcatagtcatactctcaatgcgttccgggctccgcaacgtccagcgctccggcggccccctcagcgacaacttcaggccccgcacctacggacggaacgtgctcggccagcggggcatggccgccattgacctga 92 AA PAT source 1..92 organism Homo sapiens mol_type protein MKTFAALLSAVTLALSVRAQAAVWSQCGGTPGWTGETTCVAGSVCTSLSSSYSQCVPGSATSSAPAAPSATTSGPAPTDGTCSASGAWPPLT 9 AA PAT source 1..9 organism Homo sapiens mol_type protein AVLTYLRGE 9 AA PAT source 1..9 organism Homo sapiens mol_type protein AVLTYLRGA 9 AA PAT source 1..9 organism Homo sapiens mol_type protein AVPTYPRGE 9 AA PAT source 1..9 organism Homo sapiens mol_type protein AVAIGYRGE 8 AA PAT source 1..8 organism Homo sapiens mol_type protein AVLTYLGE 32 AA PAT source 1..32 organism synthetic construct mol_type protein VARIANT 4 note N or T VARIANT 11 note A or T VARIANT 12 note K or Q VARIANT 18 note K or Q or N or D VARIANT 21 note R or G VARIANT 22 note K or I or N VARIANT 24 note L or V VARIANT 29 note M or L LEGXEQFINAXXIIRHPXYBXXTXBNDIXLIK 32 AA PAT source 1..32 organism Homo sapiens mol_type protein LEGNEQFINAAKIIRHPQYDRKTLNNDIMLIK 32 AA PAT source 1..32 organism Pongo abelii mol_type protein LEGNEQFINAAKIIRHPQYDRKTVNNDIMLIK 32 AA PAT source 1..32 organism Papio anubis mol_type protein LEGTEQFINAAKIIRHPDYDRKTLNNDILLIK 32 AA PAT source 1..32 organism Rhinopithecus roxellana mol_type protein LEGTEQFINAAKIIRHPNYNRITLDNDILLIK 32 AA PAT source 1..32 organism Pan paniscus mol_type protein LEGNEQFINAAKIIRHPKYNRITLNNDIMLIK 32 AA PAT source 1..32 organism Rhinopithecus bieti mol_type protein LEGNEQFINATKIIRHPKYNGNTLNNDIMLIK 32 AA PAT source 1..32 organism Rhinopithecus roxellana mol_type protein LEGNEQFINATQIIRHPKYNGNTLNNDIMLIK 7 AA PAT source 1..7 organism synthetic construct mol_type protein SITE 1..7 note Cysteine Leucine thioester (Cys-Leu) SITE 6 note Lys side chain links the tripeptide ALE CALRDKL 5 AA PAT source 1..5 organism synthetic construct mol_type protein SITE 5 note Ser is linked to another sequence through an amide linkage between Ser and a side chain of a Lys in the other sequence LRDQS 6 AA PAT source 1..6 organism synthetic construct mol_type protein REGION 1..6 note Circular peptide SITE 4 note The side chain of Lys is linked via an amide linkage to another sequence ALFKNG 43 DNA PAT source 1..43 organism synthetic construct mol_type other DNA misc_feature 1..7 note DNA fragment misc_feature 8..42 note RNA fragment misc_feature 43 note DNA fragment agaccttcggagtctcctgttgaacagatagtcaaagtagatc 216 DNA PAT source 1..216 organism Homo sapiens mol_type genomic DNA CDS <1..>216 protein_id 95 translation HHAAECGFCPQQWQVLRGSLCICEGPAEGWFISRCWLWCGPQVQGFIFGEGKEGGGDRRAEASPQEFWECTW catcacgcagcagaatgtggattttgtcctcaacaatggcaagttctacgtgggagtctgtgcatttgtgagggtccagctgaaggatggttcatatcaagatgttggttatggtgtgggcctcaagtccaaggctttatctttggagaaggcaaggaaggaggcggtgacagacgggctgaagcgagccctcaggagttttgggaatgcacttgg 72 AA PAT source 1..72 organism Homo sapiens mol_type protein HHAAECGFCPQQWQVLRGSLCICEGPAEGWFISRCWLWCGPQVQGFIFGEGKEGGGDRRAEASPQEFWECTW 17 AA PAT source 1..17 organism Homo sapiens mol_type protein VARIANT 9 note Ile, Ala, Phe, Tyr, aIle, MeIle, or Nle LEYCLKRWXETISHCAW 13 AA PAT source 1..13 organism Homo sapiens mol_type protein MOD_RES 7 note Arginine may be deiminated to form citrulline LEYCLKRWETISH 212 DNA PAT source 1..212 organism Homo sapiens mol_type other DNA misc_feature 212^1 note The molecule is circular atggataatgaagaagttaacgaagaatgtatgagattatttttcaagaacgctcgtgcgcatctggataaacatctaacatcaaggttgacatgcgatgaaaatgaaaatgcatatatcacgttcagatgcttcctggatggaatacatcgcaaatctactaggtttctcgaagagctacttttgaaacaagaaaatatgtaccaccaatg 12 DNA PAT source 1..12 organism synthetic construct mol_type other DNA misc_feature 12 note This residue is connected to an inverted nucleotide sequence through a 3'-3' phosphodiester bond to a thymidine 3'-monophosphate attgactaagtg 13 DNA PAT source 1..13 organism synthetic construct mol_type other DNA misc_feature 13 note This residue is connected to an inverted nucleotide sequence through a 3'-3' phosphodiester bond to a guanosine 3'-monophosphate tcagttacccctt 13 DNA PAT source 1..13 organism synthetic construct mol_type other DNA misc_feature 13 note This residue is connected to another sequence via a 3'-3'-phosphodiester bond to a thymidine 3'-monophosphate that is in turn connected to another sequence via a 5'-5'-phosphodiester bond attgactaagtgc 11 DNA PAT source 1..11 organism synthetic construct mol_type other DNA misc_feature 1 note This residue is connected to another sequence via a 5'-5' phosphodiester bond to a thymidine 3'-monophosphate that is in turn connected to another sequence via a 3'-3' phosphodiester bond gcccattgact